PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10026822m
Common NameCARUB_v10026822mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 311aa    MW: 35027.5 Da    PI: 6.0765
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10026822mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W +eEd++l+++++++G  +W++ ++  g++R++k+c++rw +yl
  Carubv10026822m 14 KGPWLPEEDDKLIKYIHKHGHSSWSALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding55.99.8e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++++eE+e ++++++ lG++ W+ Ia++++ gRt++++k++w+++l
  Carubv10026822m  67 RGKFSPEEEETILNLHAVLGNK-WSMIASHLP-GRTDNEIKNFWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.549961IPR017930Myb domain
SuperFamilySSF466893.71E-3011108IPR009057Homeodomain-like
SMARTSM007172.0E-141363IPR001005SANT/Myb domain
PfamPF002491.8E-161461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-241568IPR009057Homeodomain-like
CDDcd001671.71E-111661No hitNo description
PROSITE profilePS5129427.44262116IPR017930Myb domain
SMARTSM007171.2E-1666114IPR001005SANT/Myb domain
PfamPF002498.6E-1667112IPR001005SANT/Myb domain
CDDcd001678.25E-1369112No hitNo description
Gene3DG3DSA:1.10.10.602.4E-2869117IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MGRSPGSDEA GLKKGPWLPE EDDKLIKYIH KHGHSSWSAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SPEEEETILN LHAVLGNKWS MIASHLPGRT DNEIKNFWNT HLKKKLIQMG  120
FDPMTHRPRT DDIFSSLSQL MSLSNLRGVA DLQHQVPIEE QALLNLHAEM AKLQLFQYLL  180
QPPPMSSTSI NPNDLSILNL LIKENSNTSN LDLGFLSSHL QDFNNNLPSL KALDDNHFSQ  240
KSSPIWFSEP PSLNQTMLPF HDPCAQSVDG FCGNQASSSQ DQEVAVTDAV EWPDQQLFDD  300
SMFPDIPYQS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-29121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196460.0AY519646.1 Arabidopsis thaliana MYB transcription factor (At5g65230) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006279657.10.0hypothetical protein CARUB_v10026822mg
SwissprotQ8GWP03e-72MYB39_ARATH; Transcription factor MYB39
TrEMBLR0GJT70.0R0GJT7_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.8__2570__AT5G65230.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65230.11e-173myb domain protein 53